DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and CG13833

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster


Alignment Length:203 Identity:52/203 - (25%)
Similarity:87/203 - (42%) Gaps:19/203 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGD----KVVFVPVDVTSE 62
            |...|::|||...|||||.:..|||:|..:.:.|:..|...:..|::.|    :......:||:.
  Fly    50 IAGEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTVKQIQDIYKVRAKAYKANVTNY 114

  Fly    63 KDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSA 127
            .|:........::.|.:.:.||.||.......||.:.      .|.|.:||:|....|....:..
  Fly   115 DDLVELNSKVVEEMGPVTVLVNNAGVMMHRNMFNPDP------ADVQLMINVNLTSHFWTKLVFL 173

  Fly   128 GLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVG--MTLPIARDLSTQ-GIRICT 189
            ..|      ::.::|.||..:|:|........|.|:.:|:..:.  .||.:..||..| .|.:.|
  Fly   174 PKM------KELRKGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRMELDLENQKDIHVTT 232

  Fly   190 IAPGLFNT 197
            :.|....|
  Fly   233 VLPSFLRT 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 51/202 (25%)
CG13833NP_651111.1 adh_short 53..241 CDD:278532 51/200 (26%)
NADB_Rossmann 54..297 CDD:304358 51/199 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447544
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.