DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and naz

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster


Alignment Length:255 Identity:65/255 - (25%)
Similarity:104/255 - (40%) Gaps:61/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVA----KELGDKV---------- 52
            ||..:.:||||.||:|...|:.||.:|..:|||......|...|    :|||.:.          
  Fly    47 IKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKRELGCRTPLNSLDEDDN 111

  Fly    53 ----VFVP---VDVTSEKDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLED-FQ 109
                .||.   :|:.|.:.|.........:|.|:|:.||.||...|        |.....|| |:
  Fly   112 PEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFA--------NTQMPTEDGFE 168

  Fly   110 RVININTVGTFNVIRLSAGLMGANEPN-QDGQRGVIVNTASVA------AFDGQI---------- 157
            |...:|.:..|.:..|..       |: |..::|.|:..::.|      .||..:          
  Fly   169 RHSQVNYLAPFLLTHLLL-------PHLQRSEQGRILFVSAHAHQGAKIDFDDPLNVGTWSVKFH 226

  Fly   158 GQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPGLF-------NTPMLAALPEKVRTF 210
            .:.|::.||..|:..|..:||:|....:.:....|||.       |:|::::|..|..|:
  Fly   227 AREAFAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHFRNSPLMSSLCVKAVTY 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 64/254 (25%)
nazNP_001287387.1 FabG 47..318 CDD:223959 65/255 (25%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 63/252 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447637
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.