DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and si:ch211-107o10.3

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001186229.1 Gene:si:ch211-107o10.3 / 407663 ZFINID:ZDB-GENE-030131-4716 Length:327 Species:Danio rerio


Alignment Length:209 Identity:61/209 - (29%)
Similarity:96/209 - (45%) Gaps:31/209 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL-----GDKVVFVPVDVTSEKDVSA 67
            |:|||.:|:|:.||..:||:||.||||....|:.::.|:|:     .:.|....:|:.|.:.|..
Zfish    53 LITGGNTGIGKETAVDMAKRGARVILACRDMSRAHKAAEEIRKRSGNENVTVKMLDLASLQSVRD 117

  Fly    68 ALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLMGA 132
            .::..:....|||:.:|.||.....|.        |..|.|:..|.:|.:|.|.:..|...|:..
Zfish   118 LVKDVQQSEQRLDILINNAGVMMCPKW--------HTDEGFEMQIGVNHLGHFLLTNLLLDLLKK 174

  Fly   133 NEPNQDGQRGVIVNTASVAAFDGQIG------------QAAYSASKAAVVGMTLPIARDLSTQGI 185
            :.|::      |||.||||...|:|.            ..:|..||.|.|..|..:|..|...|:
Zfish   175 SAPSR------IVNVASVAHERGKINFNDINMDKDYDPYQSYYRSKLANVLFTRELAIKLRDTGV 233

  Fly   186 RICTIAPGLFNTPM 199
            ....:.||:..|.:
Zfish   234 TTYALHPGVIRTEL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 61/209 (29%)
si:ch211-107o10.3NP_001186229.1 PRK06197 48..325 CDD:235737 61/209 (29%)
NADB_Rossmann 49..320 CDD:304358 61/209 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.