DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and CG12171

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster


Alignment Length:263 Identity:76/263 - (28%)
Similarity:114/263 - (43%) Gaps:24/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL----GDKVVFVPVDVTSEK 63
            |:.|.:|||.:||:|..|:..|||.|..:.:......|.||.|:::    |...:.|..|:.||.
  Fly     5 KDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSES 69

  Fly    64 DVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAG 128
            ||...:.....|.||:|:.||.||........|.:      ||.|.||:|.|....:.:..|.. 
  Fly    70 DVQGIVSATLAKHGRIDVLVNNAGILELGSIENTS------LEQFDRVMNTNVRSLYQLTHLVT- 127

  Fly   129 LMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPG 193
                  |.....:|.|||.:||.......|..||:.|||||...|..:|.:|:.:|:|:.::.||
  Fly   128 ------PELIKTKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPG 186

  Fly   194 LFNTPM--LAALPEKVRTFLAKSIPFPQRLGEPSEYAHLVQAIY-----ENPLLNGEVIRIDGAL 251
            :..|.:  ...|.::......:.......||.|.|...:..||.     |.....|..:.:||..
  Fly   187 VIITELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGR 251

  Fly   252 RMM 254
            ..|
  Fly   252 HAM 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 76/263 (29%)
CG12171NP_649563.1 fabG 2..251 CDD:235975 75/258 (29%)
NADB_Rossmann 4..254 CDD:304358 75/261 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.