DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and Pdh

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_524105.2 Gene:Pdh / 39812 FlyBaseID:FBgn0011693 Length:278 Species:Drosophila melanogaster


Alignment Length:271 Identity:79/271 - (29%)
Similarity:118/271 - (43%) Gaps:47/271 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KNAVSLVTGGASGLGRATAERLAKQGAS-VILADLPSSKGNEV---AKELGDKVVFVPVDVTSEK 63
            ||||  |||||.|:|...:::|...||: |.:.||..:....|   |......|:.:.:||.::|
  Fly    23 KNAV--VTGGAGGIGLQVSKQLLAAGAAKVAIIDLQDNLEEFVKLRAAHPTQSVMIIKMDVANKK 85

  Fly    64 DVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAG 128
            .|.|..:.....||.:|:.||.||.        ||.      :|.||.:.:|..|..|....:..
  Fly    86 GVEATYEEIAKTFGNIDIVVNVAGI--------FND------KDVQRTLLVNLGGIINSTLSALP 136

  Fly   129 LMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQ--GIRICTIA 191
            .||   .:..|:.|::||.:||...|.......|.|:||.::..|..:|.:...|  ||:..|:.
  Fly   137 YMG---KDNGGKGGIVVNMSSVVGLDPMFIIPVYGATKAGIINFTRCLANEKYYQRSGIKFVTVC 198

  Fly   192 PGLFNTPMLAALPEKVRTFLAKSIPFPQ----------RLGEPS--EYAHLVQAIYENPLLNGEV 244
            ||...|.|.....||        |.||:          ||.:.|  :.:..:..:.|.. .||.|
  Fly   199 PGATMTDMFTNFTEK--------IIFPETSDETYRILDRLNKQSAADVSRCILNVLEKD-KNGAV 254

  Fly   245 IRIDGALRMMP 255
            ..|:|. |:.|
  Fly   255 YVIEGK-RVYP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 78/269 (29%)
PdhNP_524105.2 NADB_Rossmann 23..259 CDD:304358 76/263 (29%)
adh_short 23..214 CDD:278532 65/217 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.