DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and Y37E11AM.3

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001294377.1 Gene:Y37E11AM.3 / 36805052 WormBaseID:WBGene00021367 Length:347 Species:Caenorhabditis elegans


Alignment Length:244 Identity:56/244 - (22%)
Similarity:99/244 - (40%) Gaps:41/244 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLVTGGASGLGRATAERLAKQGASVIL------------ADLPSSKGNEVAKELG--DKVVFVPV 57
            ::||||:.|:|...|..|.::|..|.:            |||     ..:|.:.|  .||.:..:
 Worm    41 AIVTGGSKGIGFQLAVGLIERGCHVTIVARNVKDLEKACADL-----QVLADQRGQRQKVHWKSI 100

  Fly    58 DVTSEKDV-SAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFN 121
            |:|...|| .:|...|..:.|.:|:.:|.||.:........      .:.||::.:.:|.:...:
 Worm   101 DMTGGYDVIKSAFDDAARELGPIDILINNAGHSVQAPFCEL------PITDFEKQMAVNYLSAVH 159

  Fly   122 VIRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIR 186
            ..|.....|      :..:.|.|...:|.|......|.:|||.:|.|:.|....:..:|....:.
 Worm   160 ATRAVVDDM------KTRKTGHISFVSSAAGQFAIFGYSAYSPTKFALRGFADTLHMELLPYKVN 218

  Fly   187 ICTIAPGLFNTP----MLAALPEKVRTFL-AKSIPFPQRLGEPSEYAHL 230
            :..:.|...:|.    .|..:||:.:... |..:..|:.:.|    |||
 Worm   219 VGVLYPPNTDTEGFKVELETMPEETKKMSEAAGLFTPKDVAE----AHL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 56/244 (23%)
Y37E11AM.3NP_001294377.1 KDSR-like_SDR_c 39..275 CDD:187643 56/244 (23%)
adh_short 39..240 CDD:278532 48/215 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.