DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and CG8888

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster


Alignment Length:221 Identity:44/221 - (19%)
Similarity:78/221 - (35%) Gaps:71/221 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVTGGASGLGRATAERLAKQGASVILA-DLPSSKGNE--VAKEL-GDKVVFVPVDVTSEKDVSAA 68
            |:||..:.|....|::|...|.:|... :.|..:.:|  :.||: ..::..:.:||||||.:..|
  Fly    99 LITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIEESDEAKILKEVTSGRMKLLHLDVTSEKTILEA 163

  Fly    69 LQTAKD-------------------KFGRLD----------LTVNCAGTATAVKTFNFNKNVAHR 104
            .:....                   ..|.|:          |.:|..|:|...:.|......||.
  Fly   164 ARYVSQHLPHGAEGLWSVVHCAHWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFLPLVRRAHG 228

  Fly   105 LEDFQRVININTVGTFNVIRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAV 169
                            .|:.|::||.....|    .||:                  ..|::|||
  Fly   229 ----------------RVVFLTSGLNRVPSP----VRGI------------------QCATQAAV 255

  Fly   170 VGMTLPIARDLSTQGIRICTIAPGLF 195
            ......:.:::.|:|:.:..:|.|.|
  Fly   256 DCFAACLRQEMRTRGVDVSVVAAGEF 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 44/221 (20%)
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 44/221 (20%)
adh_short 96..293 CDD:278532 44/221 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447592
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.