DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and CG2070

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster


Alignment Length:217 Identity:56/217 - (25%)
Similarity:99/217 - (45%) Gaps:33/217 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATAERLAKQGASVILA--DLPSSKG--NEVAKELGDKVVFV-PVDVTSEKDV 65
            |::|||...|:|:.|...||::||:|.:|  |:...:.  .|:.|...::.:|. .:|:.|.|.:
  Fly    45 VAIVTGCNQGIGKETVLELARRGATVYMACRDMKKCENARREIIKATNNQNIFARQLDLCSMKSI 109

  Fly    66 SAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLED-FQRVININTVGTFNVIRLSAGL 129
            .......|.:..:|.:.:|.||.....|...         || |:..|.:|.:|.|.:..|...:
  Fly   110 RNFAAGFKREQNKLHILINNAGIMDCPKMLT---------EDGFEMQIGVNHMGHFLLTLLLLDV 165

  Fly   130 MGANEPNQDGQRGVIVNTASVAAFDGQI------------GQAAYSASKAAVVGMTLPIARDLST 182
            :.::.|::      :|..:|:|...|:|            .:.||..||.|.|..|..:|:.||.
  Fly   166 LKSSAPSR------VVVLSSIAHRFGRIKRDDLNSEKSYDRKMAYCQSKLANVLFTRELAKRLSG 224

  Fly   183 QGIRICTIAPGLFNTPMLAALP 204
            .|:.:..:.||:.||.:....|
  Fly   225 TGVTVNALHPGVVNTELFRNTP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 56/217 (26%)
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 56/217 (26%)
NADB_Rossmann 43..317 CDD:304358 56/217 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447635
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.