DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and CG30491

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster


Alignment Length:212 Identity:50/212 - (23%)
Similarity:93/212 - (43%) Gaps:31/212 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL----GDKVVFV-PVDVTSEKDV 65
            |.:|||..:|:|:.|...:||:|.:|.:|.....|..|..:|:    .:|.|:. ..|:.|::.:
  Fly    47 VFIVTGANTGIGKETVREIAKRGGTVYMACRNLKKCEEAREEIVLETKNKYVYCRQCDLASQESI 111

  Fly    66 SAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLM 130
            ...:...|.:...|.:.:|.||.....::..        .:..:..:.:|.:|.|.:..|...|:
  Fly   112 RHFVAAFKREQEHLHVLINNAGVMRCPRSLT--------SDGIELQLGVNHMGHFLLTNLLLDLL 168

  Fly   131 GANEPNQDGQRGVIVNTASVAAFDGQIGQA------------AYSASKAAVVGMTLPIARDLSTQ 183
            ..:.|::      |||.:|:|...|:|...            |||.||.|.|..|..:|:.|...
  Fly   169 KKSSPSR------IVNVSSLAHTRGEINTGDLNSDKSYDEGKAYSQSKLANVLFTRELAKRLEGT 227

  Fly   184 GIRICTIAPGLFNTPML 200
            .:....:.||:.:|.::
  Fly   228 NVTANALHPGVVDTEII 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 50/212 (24%)
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 50/212 (24%)
NADB_Rossmann 45..319 CDD:304358 50/212 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447632
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.