DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and CG9265

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster


Alignment Length:304 Identity:76/304 - (25%)
Similarity:118/304 - (38%) Gaps:75/304 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATAERLAKQGASVILADLPSSKG----NEVAKELGDKVVFVPVDVTSEKDVS 66
            ::|:|||.:||||..||||.|.|..|::.|: :.||    .::.:|.|.......||::.:::|.
  Fly    88 IALITGGGNGLGRLLAERLGKMGTKVVIWDI-NKKGIAETVQIVEEAGGYCKGYVVDISKKEEVY 151

  Fly    67 AALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLED----FQRVININTVGTFNVIRLSA 127
            .|....:|:.|.:.|.:|.||..:.:          |.|:.    .:|..|:|.:..|...:...
  Fly   152 KAADVIRDEVGDITLLINNAGVVSGL----------HLLDTPDHLIERSFNVNVMAHFWTTKAFL 206

  Fly   128 GLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQG---IRICT 189
            ..|..|:      ||.|...||:|...|......|.|||.|.||....:..:|...|   ||...
  Fly   207 PKMIEND------RGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVLGHTNIRTTC 265

  Fly   190 IAP------GLFN-------------------------TPMLAALPEKVRTFLAKSIPFP----- 218
            |.|      |:|:                         ...||.:|..::..|:....||     
  Fly   266 ICPFFIQATGMFDDVNARWVPTLNPNDVADRVIAAIRKNEKLAVIPGFLKVLLSFKWTFPWGCVG 330

  Fly   219 ---QRL-------GEPSEYAHLVQAIYENPLLN-GEVIRIDGAL 251
               :||       |.||..|.....:..|..|. .::..:|..|
  Fly   331 GLLKRLVPDASPHGLPSSIAVPTVPLNSNSKLTAADIAALDAEL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 76/304 (25%)
CG9265NP_001260655.1 fabG 82..299 CDD:235546 60/227 (26%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 66/256 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447608
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.