DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and CG13284

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001260523.1 Gene:CG13284 / 35021 FlyBaseID:FBgn0032614 Length:339 Species:Drosophila melanogaster


Alignment Length:245 Identity:59/245 - (24%)
Similarity:102/245 - (41%) Gaps:35/245 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLVTGGASGLGRATAERLAKQGASVILADLPSSK----GNEVAKELGDKVVFVPVDVTSEKDVSA 67
            ::|||...|:|:..|..||:||.:::|......|    .||:..:...|..::..|....::|..
  Fly    73 AVVTGATDGIGKEYARELARQGINLVLISRTKEKLIAVTNEIESQYKVKTKWIAADFAKGREVYD 137

  Fly    68 ALQTAKDKFG-RLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLMG 131
              |..|:..| .:.:.||..|     ..:...:::....||.  :.|:.||...:|..|:..:: 
  Fly   138 --QIEKELAGIDVGILVNNVG-----MMYEHPESLDLVSEDL--LWNLLTVNMGSVTMLTRKIL- 192

  Fly   132 ANEPNQDGQR-GVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPGLF 195
               |...|:| |.|||..|.:..........|:|||..|...:..:..:::...|.:..:.|...
  Fly   193 ---PQMIGRRKGAIVNLGSSSELQPLPNMTVYAASKKFVTYFSKALELEVAEHNIHVQLVMPNFV 254

  Fly   196 NTPMLAALPEKVR---------TFLAKSIPFPQRLGEPSE----YAHLVQ 232
            .|.|.|.....::         || |:|..|  .||:.||    :.|.:|
  Fly   255 VTKMNAYTDRVMQGGLFFPNAYTF-ARSAVF--TLGKTSETNGFWTHGIQ 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 59/245 (24%)
CG13284NP_001260523.1 DltE 70..323 CDD:223377 59/245 (24%)
17beta-HSD1_like_SDR_c 70..309 CDD:187614 59/245 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447629
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.