Sequence 1: | NP_523396.1 | Gene: | scu / 32789 | FlyBaseID: | FBgn0021765 | Length: | 255 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_835236.2 | Gene: | HSD17B13 / 345275 | HGNCID: | 18685 | Length: | 300 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 54/206 - (26%) |
---|---|---|---|
Similarity: | 87/206 - (42%) | Gaps: | 26/206 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKE---LGDKVVFVPVDVTSEK 63
Fly 64 DVSAALQTAKDKFGRLDLTVNCAGT---ATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIR- 124
Fly 125 LSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLST---QGIR 186
Fly 187 ICTIAPGLFNT 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
scu | NP_523396.1 | HSD10-like_SDR_c | 3..255 | CDD:187629 | 54/205 (26%) |
HSD17B13 | NP_835236.2 | 17beta-HSDXI-like_SDR_c | 38..277 | CDD:187598 | 54/202 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |