Sequence 1: | NP_523396.1 | Gene: | scu / 32789 | FlyBaseID: | FBgn0021765 | Length: | 255 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001285735.1 | Gene: | Wwox / 34090 | FlyBaseID: | FBgn0031972 | Length: | 409 | Species: | Drosophila melanogaster |
Alignment Length: | 205 | Identity: | 43/205 - (20%) |
---|---|---|---|
Similarity: | 80/205 - (39%) | Gaps: | 27/205 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 SLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELG-------DKVVFVPVDVTSEKD 64
Fly 65 VSAALQTAKDKFGRLDLTVNCAG--------TATAVKTFNFNKNVAHRLEDFQRVININTVGTFN 121
Fly 122 ---VIRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQ 183
Fly 184 GIRICTIAPG 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
scu | NP_523396.1 | HSD10-like_SDR_c | 3..255 | CDD:187629 | 43/205 (21%) |
Wwox | NP_001285735.1 | WW | 13..43 | CDD:197736 | |
WW | 54..86 | CDD:197736 | |||
PRK06196 | 104..402 | CDD:235736 | 43/205 (21%) | ||
human_WWOX_like_SDR_c-like | 121..402 | CDD:187669 | 43/205 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45447631 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |