DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and Wwox

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster


Alignment Length:205 Identity:43/205 - (20%)
Similarity:80/205 - (39%) Gaps:27/205 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELG-------DKVVFVPVDVTSEKD 64
            :|:||...|:|..||..||..|..:|.|....|......:.:.       .:..|..:|::|.:.
  Fly   124 ALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDLSSLRS 188

  Fly    65 VSAALQTAKDKFGRLDLTVNCAG--------TATAVKTFNFNKNVAHRLEDFQRVININTVGTFN 121
            |...::..|.....:|..:..||        |...::|   ...|:| |..|...:.:.|:..:.
  Fly   189 VQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLET---TFQVSH-LSHFYLTLQLETLFDYK 249

  Fly   122 ---VIRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQ 183
               ::..|.....||.|.::    :.|:..|... :......||:.:|...|.....:|:....:
  Fly   250 TRIIVLSSESHRFANLPVEN----LAVHHLSPPP-EKYWSMMAYNNAKLCNVLFAQELAQRWKQR 309

  Fly   184 GIRICTIAPG 193
            ||.:.::.||
  Fly   310 GISVFSLHPG 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 43/205 (21%)
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 43/205 (21%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 43/205 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447631
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.