DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and CG15629

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_608859.1 Gene:CG15629 / 33679 FlyBaseID:FBgn0031630 Length:325 Species:Drosophila melanogaster


Alignment Length:239 Identity:58/239 - (24%)
Similarity:95/239 - (39%) Gaps:34/239 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNE---------VAKELGDKVVFVPV 57
            |...|.|:|||..|:||..|...|:..|.:::.|:     |:         :||...|......|
  Fly    54 ISGQVVLITGGGGGVGRLIALNFARLQARIVIWDI-----NQEAIKTTVDLLAKHGYDNCKGYVV 113

  Fly    58 DVTSEKDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNV 122
            |::..:.:........::.|.:|:.:|.||.......:..:..|      .|...|||.:..:..
  Fly   114 DISDREQIYQRASQVTEEVGPVDILINNAGIVCCKPFWELHDRV------IQNTYNINIISHYWT 172

  Fly   123 IRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQG--- 184
            ::.....|..|      .||.||...||....|..|.:.|:|:|.|.:|....:..||...|   
  Fly   173 VKAFLPHMMRN------NRGHIVTVGSVTGMLGTYGCSDYAATKYACIGFHESLLTDLKAHGYDQ 231

  Fly   185 IRICTIAPGLFNTPMLAALPEKVRTFLAKSIPFPQRLGEPSEYA 228
            |::..|.|...||.|.:.:..::...|.     ||.:.:..|.|
  Fly   232 IQMSLICPYYINTGMFSGVRPRMMPMLE-----PQYVADRIENA 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 57/238 (24%)
CG15629NP_608859.1 17beta-HSDXI-like_SDR_c 58..298 CDD:187598 57/235 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447545
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.