Sequence 1: | NP_523396.1 | Gene: | scu / 32789 | FlyBaseID: | FBgn0021765 | Length: | 255 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001186220.1 | Gene: | HSD17B4 / 3295 | HGNCID: | 5213 | Length: | 761 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 53/203 - (26%) |
---|---|---|---|
Similarity: | 87/203 - (42%) | Gaps: | 46/203 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 GGASGLGRAT------AERLAKQGASVILADLPSSKGNEVAKELGDKVVFVPVDVTSEKDVSAAL 69
Fly 70 QTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRL--EDFQRVININTVGTFNVIRLSAGLMGA 132
Fly 133 NEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPGLFNT 197
Fly 198 PMLAALPE 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
scu | NP_523396.1 | HSD10-like_SDR_c | 3..255 | CDD:187629 | 53/203 (26%) |
HSD17B4 | NP_001186220.1 | hydroxyacyl-CoA-like_DH_SDR_c-like | 61..279 | CDD:187611 | 53/203 (26%) |
PLN02864 | 353..630 | CDD:178455 | |||
hot_dog | <400..468 | CDD:294345 | |||
HDE_HSD | 510..631 | CDD:239532 | |||
SCP2 | 653..756 | CDD:280250 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |