DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and HSD17B4

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001186220.1 Gene:HSD17B4 / 3295 HGNCID:5213 Length:761 Species:Homo sapiens


Alignment Length:203 Identity:53/203 - (26%)
Similarity:87/203 - (42%) Gaps:46/203 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GGASGLGRAT------AERLAKQGASVILADLPSSKGNEVAKELGDKVVFVPVDVTSEKDVSAAL 69
            |...|:|:.:      .|.:.::|...:        .|..:.|.|:|||                
Human    68 GDFKGVGKGSLAADKVVEEIRRRGGKAV--------ANYDSVEEGEKVV---------------- 108

  Fly    70 QTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRL--EDFQRVININTVGTFNVIRLSAGLMGA 132
            :||.|.|||:|:.||.||...       :::.| |:  ||:..:..::..|:|.|.|      .|
Human   109 KTALDAFGRIDVVVNNAGILR-------DRSFA-RISDEDWDIIHRVHLRGSFQVTR------AA 159

  Fly   133 NEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPGLFNT 197
            .|..:..:.|.|:.|:|.:...|..|||.|||:|..::|:...:|.:.....|...||||...:.
Human   160 WEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSR 224

  Fly   198 PMLAALPE 205
            .....:||
Human   225 MTQTVMPE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 53/203 (26%)
HSD17B4NP_001186220.1 hydroxyacyl-CoA-like_DH_SDR_c-like 61..279 CDD:187611 53/203 (26%)
PLN02864 353..630 CDD:178455
hot_dog <400..468 CDD:294345
HDE_HSD 510..631 CDD:239532
SCP2 653..756 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.