DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and HSD17B2

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_002144.1 Gene:HSD17B2 / 3294 HGNCID:5211 Length:387 Species:Homo sapiens


Alignment Length:237 Identity:62/237 - (26%)
Similarity:104/237 - (43%) Gaps:42/237 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVTGGASGLGRATAERLAKQGASVILADLPSSKG---NEVAKELGDKVVFVPVDVTSE---KD-- 64
            |||||..|||.|..:.|.:.|.:| .|.:.:..|   .|:.:....::..:.:|:|..   ||  
Human    86 LVTGGDCGLGHALCKYLDELGFTV-FAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAY 149

  Fly    65 --VSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSA 127
              |:|.||   |:  .|...:|.||    |..|..:..:. .:.|:::.:.:|..||..|.:...
Human   150 SKVAAMLQ---DR--GLWAVINNAG----VLGFPTDGELL-LMTDYKQCMAVNFFGTVEVTKTFL 204

  Fly   128 GLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAP 192
            .|:..:       :|.:||.:|:.........|:|.:|||||...:..:..:||..||::.:|.|
Human   205 PLLRKS-------KGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQP 262

  Fly   193 GLFNT--------------PMLAALPEKVRTFLAKSIPFPQR 220
            |.|.|              .:|..||.:|:....:.....||
Human   263 GGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 62/237 (26%)
HSD17B2NP_002144.1 type2_17beta_HSD-like_SDR_c 83..362 CDD:187665 62/237 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.