DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and HSD17B3

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_000188.1 Gene:HSD17B3 / 3293 HGNCID:5212 Length:310 Species:Homo sapiens


Alignment Length:229 Identity:56/229 - (24%)
Similarity:102/229 - (44%) Gaps:27/229 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL----GDKVVFVPVDVTSEKDVSA 67
            :::||...|:|:|.:..|||:|.:|:|......|...:|.|:    |..|..:..|.|.: |:  
Human    51 AVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKD-DI-- 112

  Fly    68 ALQTAKDKFGRLD--LTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLM 130
             .:..|:|...|:  :.||..|....:...:|    .:..::.|.:|:.|......:.:|....|
Human   113 -YEHIKEKLAGLEIGILVNNVGMLPNLLPSHF----LNAPDEIQSLIHCNITSVVKMTQLILKHM 172

  Fly   131 GANEPNQDGQRGVIVNTAS-VAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPGL 194
                  :..|:|:|:|.:| :|.|...: .:.||||||.|...:..:..:...:.:.|..:.|..
Human   173 ------ESRQKGLILNISSGIALFPWPL-YSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYA 230

  Fly   195 FNTPMLAALPEKVRT-----FLAKSIPFPQRLGE 223
            .:|.|...|...|.|     |:.:|:.:....||
Human   231 VSTAMTKYLNTNVITKTADEFVKESLNYVTIGGE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 56/229 (24%)
HSD17B3NP_000188.1 17beta-HSD1_like_SDR_c 48..284 CDD:187614 56/229 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.