DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and HSD17B1

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001317148.1 Gene:HSD17B1 / 3292 HGNCID:5210 Length:329 Species:Homo sapiens


Alignment Length:258 Identity:66/258 - (25%)
Similarity:102/258 - (39%) Gaps:50/258 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATAERLAKQGAS-----VILADLPSSKGN--EVAKELG---DKVVFVPVDVT 60
            |.|:||.:||:|...|.|||...:.     ..|.|| .::|.  |.|:.|.   ..:..:.:||.
Human     5 VVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDL-KTQGRLWEAARALACPPGSLETLQLDVR 68

  Fly    61 SEKDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRL 125
            ..|.|:||.:...:  ||:|:.|..||...........::..      ..|:::|.|||..::: 
Human    69 DSKSVAAARERVTE--GRVDVLVCNAGLGLLGPLEALGEDAV------ASVLDVNVVGTVRMLQ- 124

  Fly   126 SAGLMGANEPNQDGQ-RGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIR-IC 188
                  |..|:...: .|.::.|.||....|......|.|||.|:.|:...:|..|...|:. :.
Human   125 ------AFLPDMKRRGSGRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHSLS 183

  Fly   189 TIAPGLFNTPMLAALPEKVRTFLAKSIPFPQRLGEPSEY-----AHLVQAIYENPLLNGEVIR 246
            .|..|    |:..|..|||             ||.|.|.     .|.....|:....:.:|.|
Human   184 LIECG----PVHTAFMEKV-------------LGSPEEVLDRTDIHTFHRFYQYLAHSKQVFR 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 66/258 (26%)
HSD17B1NP_001317148.1 NADB_Rossmann 4..262 CDD:304358 66/258 (26%)
adh_short 5..198 CDD:278532 56/212 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..329
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.