DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and CG31809

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001097168.1 Gene:CG31809 / 318954 FlyBaseID:FBgn0051809 Length:316 Species:Drosophila melanogaster


Alignment Length:250 Identity:60/250 - (24%)
Similarity:103/250 - (41%) Gaps:46/250 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLVTGGASGLGRATAERLAKQGASVILADLPSSK----GNEVAKELGDKVVFVPVDVTSEKDVSA 67
            ::|||...|:|:..|..||:||.:::|......|    .||:..:...|:.::..|....::|.|
  Fly    51 AVVTGATDGIGKEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWIVADFAKGREVYA 115

  Fly    68 ALQTAKDKFG-RLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVI-----NINTVGTFNVIRLS 126
            .::  |:..| .:.:.||..||             .|..|...:|.     ::.||...:|..|:
  Fly   116 HIE--KELNGIEVGILVNNVGT-------------IHDPESLDKVSEDMLWDLLTVNVGSVTMLT 165

  Fly   127 AGLMGANEPNQDGQR-GVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTI 190
            ..::    |....:| |.|||..|.:.........||:|:|..|...|..:..:::...|.:..:
  Fly   166 RKIL----PQMISRRKGAIVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHNIHVQLV 226

  Fly   191 APGLFNTPMLAALPEKVRT---------FLAKSIPFPQRLGEPSE----YAHLVQ 232
            .|....|.| .:..:|||.         ..|:|..|  .||:.||    :.|.:|
  Fly   227 MPAFVATNM-NSYSDKVRQGGLLFPNAYSYARSAVF--TLGKTSETNGFWVHGLQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 59/249 (24%)
CG31809NP_001097168.1 17beta-HSD1_like_SDR_c 48..286 CDD:187614 59/249 (24%)
DltE 50..302 CDD:223377 59/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447628
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.