DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and CG12116

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_572481.1 Gene:CG12116 / 31782 FlyBaseID:FBgn0030041 Length:273 Species:Drosophila melanogaster


Alignment Length:248 Identity:43/248 - (17%)
Similarity:85/248 - (34%) Gaps:108/248 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVTGGASGLGRATA----ERLAKQGASVILADLPSSKGNEVAKELGDKVVFVPVDVTSEKDVSAA 68
            :::|.::.||::.|    .|||....::||     .:..|..:||             |..:.:.
  Fly    15 VLSGSSNPLGQSLALEFCRRLATGSLALIL-----DEDQEQLREL-------------ENHLRSE 61

  Fly    69 LQT--AKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLMG 131
            |:|  .|...|:||                  |:.::.::..::.:..|.:              
  Fly    62 LKTENVKVTIGKLD------------------KDHSNGVQLMEQALMDNFM-------------- 94

  Fly   132 ANEPNQDGQRGVIVNTASVAA------------FDGQIGQAAYS----------------ASKAA 168
            |::.||..:|.:|::....||            :...:.|..|:                ..|.|
  Fly    95 ADKDNQRFERSIILHNEGKAATHMLLEPQSDDDWKAYVQQQLYAPVALNQTWLQSKHLERVEKLA 159

  Fly   169 V-VGMTLPI--------------ARDLSTQ---------GIRICTIAPGLFNT 197
            | |..:|.:              |||:..:         |:.:.:.:|||.:|
  Fly   160 VNVTSSLMVRPLVHAGLLCSCKRARDMYFRAMAAEEYRFGVHVLSFSPGLMDT 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 43/248 (17%)
CG12116NP_572481.1 FabG 6..>212 CDD:223959 42/246 (17%)
SPR-like_SDR_c 13..269 CDD:187625 43/248 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.