Sequence 1: | NP_523396.1 | Gene: | scu / 32789 | FlyBaseID: | FBgn0021765 | Length: | 255 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_572481.1 | Gene: | CG12116 / 31782 | FlyBaseID: | FBgn0030041 | Length: | 273 | Species: | Drosophila melanogaster |
Alignment Length: | 248 | Identity: | 43/248 - (17%) |
---|---|---|---|
Similarity: | 85/248 - (34%) | Gaps: | 108/248 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 LVTGGASGLGRATA----ERLAKQGASVILADLPSSKGNEVAKELGDKVVFVPVDVTSEKDVSAA 68
Fly 69 LQT--AKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLMG 131
Fly 132 ANEPNQDGQRGVIVNTASVAA------------FDGQIGQAAYS----------------ASKAA 168
Fly 169 V-VGMTLPI--------------ARDLSTQ---------GIRICTIAPGLFNT 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
scu | NP_523396.1 | HSD10-like_SDR_c | 3..255 | CDD:187629 | 43/248 (17%) |
CG12116 | NP_572481.1 | FabG | 6..>212 | CDD:223959 | 42/246 (17%) |
SPR-like_SDR_c | 13..269 | CDD:187625 | 43/248 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |