DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and DHRS4L2

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_932349.2 Gene:DHRS4L2 / 317749 HGNCID:19731 Length:232 Species:Homo sapiens


Alignment Length:190 Identity:50/190 - (26%)
Similarity:87/190 - (45%) Gaps:16/190 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL---GDKVVFVPVDVTSEK 63
            :.|.|:|||....|:|.|.|.|||:..|.|:::.......::....|   |..|......|...:
Human    30 LTNKVALVTASTDGIGFAIARRLAQDRAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAE 94

  Fly    64 DVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAG 128
            |....:..|....|.:|:.|:.|    ||..| |...:....|.:.:.::||       ::..|.
Human    95 DRERLVAMAVKLHGGIDILVSNA----AVNPF-FGSLMDVTEEVWDKTLDIN-------VKAPAL 147

  Fly   129 LMGANEPNQDGQ-RGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRI 187
            :..|..|..:.: .|.:|..:|:|||....|.:.|:.||.|::|:...:|.:|:.:.||:
Human   148 MTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLNNTLAIELAPRNIRV 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 50/189 (26%)
DHRS4L2NP_932349.2 NADB_Rossmann 24..>210 CDD:304358 50/190 (26%)
adh_short 33..210 CDD:278532 49/187 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.