DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and Ldsdh1

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster


Alignment Length:266 Identity:67/266 - (25%)
Similarity:110/266 - (41%) Gaps:35/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL---GDKVVFVPVDVTSEK 63
            :...|.|:||...|:|:..|.:.||.||:::..|:.....|:..||:   |.|......:||..:
  Fly    56 VNGKVVLITGTGHGMGKEMALQYAKLGATILCWDVNEQTNNQTVKEIKNNGGKAFGYVCNVTKRE 120

  Fly    64 DVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAG 128
            ::....|..:.:.|.:.:.||.||....      :..:.|...:.:.:..||.:..|.:|:  |.
  Fly   121 ELIELAQKVRKEHGFIHVVVNNAGIMPC------HPLLEHTENEIRLMYEINVLSHFWIIQ--AF 177

  Fly   129 LMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQ----GIRICT 189
            |....|.|:    |.||..:|.|...|.|....|..:|.||.|....:..:|..:    .:::.|
  Fly   178 LPDMIERNE----GSIVALSSCAGLFGLINLVPYCGTKFAVRGYMAALVEELRQKNPQNNVKLTT 238

  Fly   190 IAP-----GLFNTP------MLAALPEKVRTFLAKSIPFPQRLG--EPSEYAHLVQAIYENPLLN 241
            |.|     ||...|      :...:|..|   .|.||...||.|  |.:...|.|.|.....|:.
  Fly   239 IYPYMIDTGLCKNPRYRFPNLFKLIPADV---AAGSIIEAQRQGLEEAAIPRHFVAAEKIGRLIP 300

  Fly   242 GEVIRI 247
            .:.:|:
  Fly   301 RKAMRL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 67/265 (25%)
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 50/200 (25%)
NADB_Rossmann 60..287 CDD:304358 62/241 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447625
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.