DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and spidey

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster


Alignment Length:266 Identity:64/266 - (24%)
Similarity:108/266 - (40%) Gaps:64/266 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGDK----VVFVPVDVTS------ 61
            ::|||...|:|:|.|:.||::|..::|......|.|.||||:|||    |..:.||.|.      
  Fly    55 AVVTGSTDGIGKAYAKELARRGLKLVLISRSLEKLNVVAKEIGDKYGVEVRVIDVDFTGGDEIYD 119

  Fly    62 ---EK----DVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGT 119
               ||    :|...:......:|..:..::|......     |.:|:.        ..||::|..
  Fly   120 KIREKTTGLNVGVLVNNVGISYGHPEYFLDCYKADPP-----FLRNIV--------AANIHSVTH 171

  Fly   120 FNVIRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQG 184
            ...:.| .|::..       :||||:|.:|.|........:.||::||.|...:..:..:....|
  Fly   172 MTALFL-PGMISQ-------RRGVIINVSSTAGVIPNPLLSVYSSTKAFVNKFSDDLQTEYKEHG 228

  Fly   185 IRICTIAPGLFNTPM--------LAALPEKVRTFLAKSIPFPQRLGEPSEYA------------H 229
            |.|.::.||...|.|        .|..||   |::..::   ..||..::.|            |
  Fly   229 ILIQSVQPGFVATNMSKIRKASVFAPSPE---TYVRSAL---STLGIATQTAGYLPHALLQLVIH 287

  Fly   230 LVQAIY 235
            ..:|::
  Fly   288 FTEAVF 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 64/266 (24%)
spideyNP_572420.1 PLN02780 8..321 CDD:166421 64/266 (24%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 62/259 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447521
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.