DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and CG3842

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster


Alignment Length:221 Identity:54/221 - (24%)
Similarity:93/221 - (42%) Gaps:46/221 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILA------------DLPSSKGNEVAKELGDKVVF 54
            |...|.:|||..:|:|:.|...|||:||.|.:|            |:.....|:   :|.::.  
  Fly    72 IDGKVVIVTGCNTGIGKETVLELAKRGARVYMACRDPGRCEAARLDIMDRSRNQ---QLFNRT-- 131

  Fly    55 VPVDVTSEKDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGT 119
              :|:.|.:.|...::..|.:..|||:.:|.||.....:|..        .:.|::...:|.:|.
  Fly   132 --LDLGSLQSVRNFVERFKAEESRLDILINNAGVMACPRTLT--------ADGFEQQFGVNHLGH 186

  Fly   120 FNVIRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQ-------------AAYSASKAAVVG 171
            |.:..|....:..:.|::      ||..:|.|...|:|.:             .|||.||.|.:.
  Fly   187 FLLTNLLLDRLKHSSPSR------IVVVSSAAHLFGRINREDLMSEKNYSKFFGAYSQSKLANIL 245

  Fly   172 MTLPIARDLSTQGIRICTIAPGLFNT 197
            .||.::..|...|:.:....||:..|
  Fly   246 FTLKLSTILKDTGVTVNCCHPGVVRT 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 53/220 (24%)
CG3842NP_001259270.1 FabG 71..319 CDD:223959 54/221 (24%)
NADB_Rossmann 74..347 CDD:304358 53/219 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.