DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and CG3699

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster


Alignment Length:261 Identity:81/261 - (31%)
Similarity:130/261 - (49%) Gaps:33/261 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVIL-----ADLPSSKGNEVAKEL-GDKVVFVPVDVT 60
            :.|.|.:|||.:||:|.|.|:.||::||::.|     |:|.::|     |.| |.:...|..|||
  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATK-----KSLKGTQAEIVVADVT 62

  Fly    61 SEKDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRL 125
              ||..|.:|....||||:|:.||.||........:.:      :|:|..|:|.|..|   ||.|
  Fly    63 --KDADAIVQQTLAKFGRIDVLVNNAGILGKGGLIDLD------IEEFDAVLNTNLRG---VILL 116

  Fly   126 SAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTI 190
            :..::    |:....:|.:||.:|.|......|..:|..||||:...|..:|.:::.||:|:.::
  Fly   117 TKAVL----PHLLKTKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSV 177

  Fly   191 APGLFNTPM---LAALPEKVRTFLAKSI-PFPQ-RLGEPSEYAHLVQ--AIYENPLLNGEVIRID 248
            .||...|.:   :..:.|:....|.::| ..|. |:|:.:|.|..|.  |..:.....|.:..||
  Fly   178 NPGFVVTNIHRNIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPID 242

  Fly   249 G 249
            |
  Fly   243 G 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 81/260 (31%)
CG3699NP_569875.2 fabG 1..244 CDD:235546 81/261 (31%)
NADB_Rossmann 3..248 CDD:304358 81/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.