DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and Hsd17b11

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001004209.1 Gene:Hsd17b11 / 289456 RGDID:1303235 Length:298 Species:Rattus norvegicus


Alignment Length:260 Identity:62/260 - (23%)
Similarity:109/260 - (41%) Gaps:34/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVA---KELGDKVVFVPVDVTSEK 63
            :...:.|:||...|:||.||...||....::|.|:..:...|.|   ::||.:|....||.:..:
  Rat    34 VAGEIVLITGAGHGIGRLTAYEFAKLNTKLVLWDINKNGIEETAAKCRKLGAQVHPFVVDCSQRE 98

  Fly    64 DVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAG 128
            ::.:|::..|::.|.:.:.||.||.......|      |.:....::...:|.:..|...:....
  Rat    99 EIYSAVRKVKEEVGDVSILVNNAGVVYTADLF------ATQDPQIEKTFEVNVLAHFWTTKAFLP 157

  Fly   129 LMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLST---QGIRICTI 190
            .|..|      ..|.:|..||.|.........||.:||.|.||....:..:|:.   .|:|...:
  Rat   158 AMMKN------NHGHVVTVASAAGHTVVPFLLAYCSSKFAAVGFHRALTDELAALGCTGVRTSCL 216

  Fly   191 APGLFNTPMLAALPEKVRTFLAKSIPFPQRLGEPSEYA-HLVQAIYENPLLNGEVIRIDGALRMM 254
            .|...||..:    :...|.|..::       ||.|.. ||:..|    |.|.::|.:.|::.::
  Rat   217 CPNFINTGFI----KNPSTNLGPTL-------EPEEVVEHLMHGI----LTNQKMIFVPGSIALL 266

  Fly   255  254
              Rat   267  266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 62/259 (24%)
Hsd17b11NP_001004209.1 adh_short 37..228 CDD:278532 50/206 (24%)
17beta-HSDXI-like_SDR_c 38..277 CDD:187598 62/256 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.