DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and Dhrs7b

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001008507.1 Gene:Dhrs7b / 287380 RGDID:1311243 Length:325 Species:Rattus norvegicus


Alignment Length:210 Identity:54/210 - (25%)
Similarity:93/210 - (44%) Gaps:31/210 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGD---------KVVFVPV 57
            ::|||.:|||..||||:..|......||.|:|.........|..:||.|         :...|..
  Rat    50 LRNAVVVVTGATSGLGKECARVFHAAGAKVVLCGRNVKALEEFTRELADSSSSQGQTHQPCVVTF 114

  Fly    58 DVTSEKDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQR-VININTVGTFN 121
            |:.....::.|.......||.:|:.:|.||       .::...::..:.|..| |:.||   .|.
  Rat   115 DLADPGAIAPAAAEILQCFGYVDILINNAG-------ISYRGAISDTIVDVDRKVMEIN---YFG 169

  Fly   122 VIRLSAGLMGANEPNQ-DGQRGVIVNTASVAAFDGQIG---QAAYSASKAAVVGMTLPIARDLST 182
            .:.|:..|:    |:. :.:||.||   ::::..|:|.   ::||:|||.|.......:..::..
  Rat   170 PVALTKALL----PSMVERKRGHIV---AISSIQGKISIPFRSAYAASKHATQAFFDCLRAEMKD 227

  Fly   183 QGIRICTIAPGLFNT 197
            ..|.:..|:||..:|
  Rat   228 SDIEVTVISPGYIHT 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 54/209 (26%)
Dhrs7bNP_001008507.1 11beta-HSD1_like_SDR_c 50..311 CDD:187593 54/210 (26%)
PRK06181 52..321 CDD:235726 54/208 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.