DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and SPAC922.06

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_595006.1 Gene:SPAC922.06 / 2543550 PomBaseID:SPAC922.06 Length:258 Species:Schizosaccharomyces pombe


Alignment Length:266 Identity:69/266 - (25%)
Similarity:112/266 - (42%) Gaps:46/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADL--PSSKGNEVAKELGDKVVFVPVDVTSEKD 64
            ::..|.|:||.|.|:|:...:...:.|..|...|:  ||        ::.|..:.:..||:....
pombe     3 VEGRVVLITGAAGGIGKVLCKMFTELGDRVAGIDIVDPS--------KVQDAALALQADVSKADQ 59

  Fly    65 VSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGL 129
            :..|::......|.:|:.:|.||.|.....    :.::|  |.:...:::...|.:...|.....
pombe    60 IETAIEKVIQTLGPIDVLINNAGLADDTPF----EQLSH--ESWDHDVSLVLRGNYLTQRYVIPH 118

  Fly   130 MGANEPNQDGQRGVIVNTASVAAFDGQI--GQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAP 192
            |.     :.|:.|.|||..||   :|.|  |..||||:||.:..:|..:|......|||:...||
pombe   119 MA-----KQGKGGSIVNIGSV---NGHIYLGSPAYSAAKAGLENLTKALAVRYGPLGIRVNVCAP 175

  Fly   193 GLFNTPMLAALPEKVRTFLAKSIP---------FP-QRLGEPSEYAHLV--QAIYENPLLNGEVI 245
            |...:|   |..|:.     |..|         :| .|||.|.:.|..|  .|..:|..:.|..:
pombe   176 GTIWSP---AWDERF-----KKHPDVGDRMKRWYPVGRLGTPEDVARAVIFLADSKNSFITGTTL 232

  Fly   246 RIDGAL 251
            .:||.|
pombe   233 YVDGGL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 69/265 (26%)
SPAC922.06NP_595006.1 PRK07074 6..248 CDD:180823 69/263 (26%)
SDR_c 8..235 CDD:212491 65/256 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.