DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and SPAC8E11.10

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_594161.1 Gene:SPAC8E11.10 / 2543428 PomBaseID:SPAC8E11.10 Length:255 Species:Schizosaccharomyces pombe


Alignment Length:270 Identity:74/270 - (27%)
Similarity:120/270 - (44%) Gaps:48/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGD------KVVFVPVDVT 60
            :|...:|:|||:.|:|.:.|:..|..|::|.|....:.|..|.|.||.|      |....|::..
pombe     7 LKGKTTLITGGSGGIGFSIAKAFAAAGSNVGLLYGRNKKALEYAAELRDKHGVQAKAYSCPIENR 71

  Fly    61 SEKDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAH-RLED-----FQRVININTVGT 119
            |.. :....|..::..||||:.:..||.|           :.| .|||     :.:|:.||..|.
pombe    72 SAV-IETTNQAVEELGGRLDVMIANAGIA-----------IPHLSLEDKNEDIWTKVVGINLNGA 124

  Fly   120 FNVIRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQ-----AAYSASKAAVVGMTLPIARD 179
            :    .:|...|.:...|.  :|.::.|||::   |.|..     |:|.|:||||    ..:||.
pombe   125 Y----YTAQAAGHHFKKQG--KGSLIFTASMS---GHIANWPQQWASYHATKAAV----KHLARA 176

  Fly   180 LSTQG---IRICTIAPGLFNTPMLAALPEKVRTFLAKSIPFPQRLGEPSEY--AHLVQAIYENPL 239
            |:.:.   .|:.:::||..:|.:.....|.:|....:..| ..|:|.|.|.  |:|..|...:..
pombe   177 LAVEWAPFARVNSVSPGYIDTDLTLYADENLRKKWKEYTP-QARIGLPDELPGAYLYLASDASSY 240

  Fly   240 LNGEVIRIDG 249
            ..|..|.:||
pombe   241 CTGSDIIVDG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 74/269 (28%)
SPAC8E11.10NP_594161.1 PRK05867 1..252 CDD:135631 74/270 (27%)
MDH-like_SDR_c 2..254 CDD:187610 74/270 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3886
TreeFam 1 0.960 - -
21.960

Return to query results.
Submit another query.