DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and SPAC4H3.08

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_594344.1 Gene:SPAC4H3.08 / 2543366 PomBaseID:SPAC4H3.08 Length:286 Species:Schizosaccharomyces pombe


Alignment Length:255 Identity:61/255 - (23%)
Similarity:115/255 - (45%) Gaps:31/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLVTGGASGLGRATAERLAKQGASVILADLPSSKGN-EVAKEL----GDKVVFVPVDVTSEKDVS 66
            :|:|||.||:|:|.|...|::|:.::::.||..:.: ||.::|    |.........:....:..
pombe    45 TLLTGGDSGIGKAAAVMFAREGSDLVISCLPEERDDAEVTRDLIEREGRNCWIWEGKLDKSDNCR 109

  Fly    67 AALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLED-----FQRVININTVGTFNVIRLS 126
            ..:..|..|.|.:|:.||...          .:.||..:||     :......|....|.|.:.:
pombe   110 DLVDFALKKLGWIDVLVNNIA----------YQQVAQSIEDIDDEQWDLTFKTNIFSFFWVTKAA 164

  Fly   127 AGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIA 191
            ...|.:...        |||.:|:.|:.|:.....|:::|.|:...|..::...:..|||:..:|
pombe   165 ISHMKSGSS--------IVNCSSINAYVGRPDLLDYTSTKGAITAFTRGLSNQYAQHGIRVNAVA 221

  Fly   192 PGLFNTPMLAALPEKVRTFLAKSIPFPQRLGEPSEYA--HLVQAIYENPLLNGEVIRIDG 249
            ||...||::::...|.:..|:..:|. .|:|:|.|.|  :|..|..:...:.|:.:..:|
pombe   222 PGPIYTPLVSSTFPKEKIELSDQVPL-GRMGQPVEVASCYLFLACSDGGYMTGQTLHPNG 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 61/255 (24%)
SPAC4H3.08NP_594344.1 PRK06701 3..285 CDD:235853 61/255 (24%)
SDR_c1 13..285 CDD:187613 61/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.