DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and SPAC4G9.15

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_593697.1 Gene:SPAC4G9.15 / 2543099 PomBaseID:SPAC4G9.15 Length:341 Species:Schizosaccharomyces pombe


Alignment Length:229 Identity:56/229 - (24%)
Similarity:102/229 - (44%) Gaps:35/229 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGD----KVVFVPVDVTSEKDVSA 67
            ::|||...|:|:..|.:||..|.:|:|......|.:.:||||..    |...:.:|.|       
pombe    60 AVVTGATDGIGKEYATQLAMSGFNVVLISRTQEKLDALAKELETVAKVKTRTIAIDYT------- 117

  Fly    68 ALQTAKDKFGRL--DLT-------VNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVI 123
              :|..:.|.:|  ||.       :|..|.:..:.| :|.:.....::|   :::||..||.:..
pombe   118 --KTTAETFEKLHQDLVGTPITVLINNVGQSHYMPT-SFAETTVKEMDD---IMHINCFGTLHTT 176

  Fly   124 RLSAGLM-GANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRI 187
            :....:| ...:.|:.|.|.:|:...|.|........:.|:.|||.:...:..:..::..|||.:
pombe   177 KAVLSIMLRERQKNEKGPRCLILTMGSFAGLLPSPYLSTYAGSKAFLSNWSASLGEEVKKQGIDV 241

  Fly   188 -CTIAPGLFNTPMLAALPEKVRTFLAKSIPFPQR 220
             |      ||:.::.:...|||. ...:||.|::
pombe   242 WC------FNSYLVVSAMSKVRR-PTLTIPTPKK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 56/229 (24%)
SPAC4G9.15NP_593697.1 DltE 52..338 CDD:223377 56/229 (24%)
17beta-HSD1_like_SDR_c 57..305 CDD:187614 56/229 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.