DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and SPCC1739.08c

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_588416.1 Gene:SPCC1739.08c / 2539211 PomBaseID:SPCC1739.08c Length:261 Species:Schizosaccharomyces pombe


Alignment Length:261 Identity:77/261 - (29%)
Similarity:123/261 - (47%) Gaps:40/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KNAVSLVTGGASGLGRATAERLAKQGASVILADL---PSSKGNEVAKELGDKVVFVPVDVTSEKD 64
            ||.|  |.|.|.|:|.:.|...|:.|.:||:..|   |:.|..::|:|.|.:|..:.:|::....
pombe    22 KNCV--VFGAAKGIGFSIATAFAQAGGNVIITYLTTDPTEKAKKLAEETGVQVHTLKIDISRSDT 84

  Fly    65 VSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNV----AHRLEDFQRVININTVGTFNVIRL 125
            |.|.::..:..|..:.:.|..||       ..|.::|    .|   :|::|:||||...:.|   
pombe    85 VEAGVEEIQKIFKEIHVVVANAG-------MPFRRSVLDSPPH---EFEKVMNINTNSVYRV--- 136

  Fly   126 SAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQ--AAYSASKAAVVGMTLPIARDLSTQGIRIC 188
             |..||.....|.  .|.::.|||::|......|  |||.||||||..:...:|.:.: :..||.
pombe   137 -AYYMGKIFKKQG--FGNLIATASMSATIVNAPQHIAAYCASKAAVRQLCKALAVEWA-EFARIN 197

  Fly   189 TIAPGLFNTPMLAALPEKVRTFLAK---SIPFPQRLGEPSEY--AHLVQAIYENPLLNGEVIRID 248
            :::||.|.|.|..      ..||.:   .:|| :|||...|.  .:|..|...:..:.|..:.:|
pombe   198 SVSPGYFATDMPG------YEFLKQWEPYVPF-KRLGLTPELRGTYLYLASNASSFVTGLDLIVD 255

  Fly   249 G 249
            |
pombe   256 G 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 77/261 (30%)
SPCC1739.08cNP_588416.1 PRK05867 13..260 CDD:135631 77/261 (30%)
MDH-like_SDR_c 14..260 CDD:187610 77/261 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3886
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.