DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and CG30495

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster


Alignment Length:273 Identity:71/273 - (26%)
Similarity:115/273 - (42%) Gaps:60/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATAERLAKQGASVILADLPSSK----GNEVAKELGDKVVFV-PVDVTSEKDV 65
            |::||||.:|||:.|...||::||:|.:|.....|    ..|:.||.|:..||. ..|::|...:
  Fly    47 VAIVTGGNTGLGKETVMELARRGATVYMACRNKEKVERARREIVKETGNSNVFSRECDLSSLDSI 111

  Fly    66 SAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRL--EDFQRVININTVGTFNVIRLSAG 128
            ....:..|.:...|.:.:|.||....          .|||  |.|:..:.:|.:|.|.:..|..|
  Fly   112 RKFAENFKKEQRVLHILINNAGVFWE----------PHRLTKEGFEMHLGVNHIGHFLLTNLLLG 166

  Fly   129 LMGANEPNQDGQRGVIVNTASVAAFDGQI------------GQAAYSASKAAVVGMTLPIARDLS 181
            ::..:.|::      :|..||.|...|||            ...||..||.|.:..|..:|:.|.
  Fly   167 VLERSAPSR------VVVVASRAHERGQIKVDDINSSDFYDEGVAYCQSKLANILFTRELAKRLE 225

  Fly   182 TQGIRICTIAPGLFNTPMLAALPEKVRTFLAKSIPFPQRLGEPSEYAHLVQAIYENPLL------ 240
            ..|:.:..:.||:.:|.            :|:::.|.|     :::|..|......|||      
  Fly   226 GTGVTVNALNPGIADTE------------IARNMIFFQ-----TKFAQYVVETILRPLLWAVMKT 273

  Fly   241 --NGEVIRIDGAL 251
              ||....:..||
  Fly   274 PKNGAQTTLYAAL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 71/273 (26%)
CG30495NP_001260785.1 FabG 44..296 CDD:223959 71/273 (26%)
NADB_Rossmann 45..323 CDD:304358 71/273 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447633
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.