DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and F26D2.15

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_507157.1 Gene:F26D2.15 / 184969 WormBaseID:WBGene00009153 Length:279 Species:Caenorhabditis elegans


Alignment Length:268 Identity:67/268 - (25%)
Similarity:121/268 - (45%) Gaps:39/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL------GDKVVFVPVDVTSEKD 64
            |:|:||.::|:|||.|...|:|||.|.:....:.:..|...|:      .:.::.:..||.:::.
 Worm     8 VALITGSSNGIGRAAAILFAQQGAKVTITGRNAERLKETRHEIKKSGIPAENILAIVADVITDEG 72

  Fly    65 VSAALQTAKDKFGRLDLTVNCAGTA--TAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSA 127
            ....:.....|||.||:.||.||.|  .|......:::::  :.|....||:.:|.|        
 Worm    73 QMRLINDTVRKFGHLDILVNNAGGALMDAQGRVGMDQDIS--VFDNTMQINMRSVVT-------- 127

  Fly   128 GLMGANEPNQDGQRGVIVNTASVAAFDGQIGQ---AAYSASKAAVVGMTLPIARDLSTQGIRICT 189
             |:...:.:....:|.|:|.:::||  |..|.   ..|..||||:...|...|..|...|:|:.:
 Worm   128 -LVQKAKEHLIKSKGEIINVSAMAA--GHHGDPIATFYGMSKAALDQFTRSSAISLIQHGVRVNS 189

  Fly   190 IAPGLFNT--------PMLAALPEKVRTFLA--KSIPFPQRLGEPSEYAHLVQAIYENPL---LN 241
            ::||...|        |.:|.  :||.:|..  |.......:.:|.:.|.::..:.:..:   :.
 Worm   190 VSPGFTKTGFGEAMGFPPIAM--KKVISFYESHKECAPSGAIAQPGDIAQVILFLADRTMSSYII 252

  Fly   242 GEVIRIDG 249
            |:.|..||
 Worm   253 GQSIIADG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 67/268 (25%)
F26D2.15NP_507157.1 fabG 3..265 CDD:235975 67/268 (25%)
NADB_Rossmann 4..265 CDD:304358 67/268 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1074094at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.