DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and stdh-4

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001355440.1 Gene:stdh-4 / 184934 WormBaseID:WBGene00006435 Length:317 Species:Caenorhabditis elegans


Alignment Length:209 Identity:60/209 - (28%)
Similarity:97/209 - (46%) Gaps:33/209 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGDK-----VVFVPVDVT--SEKD 64
            ::|||...|:||:.|..||::|.::.|.....||..:..|::.:|     |.:...|.|  |.:|
 Worm    56 AVVTGATDGIGRSYALDLARRGFNIFLISRTKSKLVKTKKQILNKYSDIEVRYAICDFTRVSYED 120

  Fly    65 VSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLE----DFQRVININTVGTFNVIRL 125
            ....|.:..:.  .:.:.:|..|..     |: |..|.||:|    ....|||:|.:   .|..|
 Worm   121 YKRLLHSLNEV--DIGILINNVGMC-----FD-NPEVLHRVEGGIDTLTNVINVNIL---PVTLL 174

  Fly   126 SAGLMGANEPNQDGQR-GVIVNTASVAAFDGQIGQA---AYSASKAAVVGMTLPIARDLSTQGIR 186
            :||::    |....:: |:|||..|.|   |.|..|   .|||:|..:...|..:.::...:||.
 Worm   175 TAGIL----PQMMARKSGIIVNIGSAA---GSIHMAKWSVYSATKKYIEWFTSILQKEYENEGII 232

  Fly   187 ICTIAPGLFNTPML 200
            ..||.|.|.:|.|:
 Worm   233 CQTITPLLVSTNMI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 60/209 (29%)
stdh-4NP_001355440.1 17beta-HSD1_like_SDR_c 53..295 CDD:187614 60/209 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.