DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and stdh-2

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_507092.1 Gene:stdh-2 / 184337 WormBaseID:WBGene00008678 Length:315 Species:Caenorhabditis elegans


Alignment Length:247 Identity:61/247 - (24%)
Similarity:105/247 - (42%) Gaps:39/247 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGDK-----VVFVPVDVTS----- 61
            ::|||...|:|::.:..||::|.:|.:.....||..:..|::.:|     |.|...|.|:     
 Worm    50 AVVTGATDGIGKSYSFELARRGFNVYIVSRTQSKLEQTKKDILEKQPDIEVRFATYDFTNPSVTD 114

  Fly    62 -EKDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLE-DFQRVININTVGTFNVIR 124
             ||.:|...:.:      :.:.:|..|     ..|:: ..:.|::. ....:.|:..:.|.....
 Worm   115 YEKLLSKLNEVS------VGILINNVG-----MFFDY-PEMLHKINGGIDSIANVIIINTLPATL 167

  Fly   125 LSAGLMGANEPNQDGQR-GVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRIC 188
            ||||::    |....:: |:|||..|.|........:.|||:|..|..:|..:.::.|..||...
 Worm   168 LSAGIL----PQMVSRKAGIIVNIGSFAGVVKLAEWSIYSATKKYVEWLTGCLRKEYSHHGIIFQ 228

  Fly   189 TIAPGLFNTPMLAALPEKVRTFLAKSIPFPQ----RLGEPSE----YAHLVQ 232
            .|.|.:..|.| |..| ....|...|..|.:    .:|..||    .||.:|
 Worm   229 AITPAMVATKM-AGNP-NTSFFCPDSDTFARSALNTIGHASETTGYIAHQIQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 61/247 (25%)
stdh-2NP_507092.1 PLN02780 19..312 CDD:166421 61/247 (25%)
17beta-HSD1_like_SDR_c 47..289 CDD:187614 61/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.