DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and F02C12.2

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_510229.1 Gene:F02C12.2 / 184076 WormBaseID:WBGene00008516 Length:278 Species:Caenorhabditis elegans


Alignment Length:201 Identity:62/201 - (30%)
Similarity:97/201 - (48%) Gaps:20/201 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGD------KVVFVPVDVTSEKD 64
            |:::||.:||:||.||...||:||.|.:......|..|..|.|.|      ..:.||.|:|....
 Worm     9 VAIITGSSSGIGRETALLFAKEGAKVTVTGRSEEKLEETKKALLDAGIKESNFLIVPADITFSTG 73

  Fly    65 VSAALQTAKDKFGRLDLTVNCAGTA--TAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSA 127
            ....:.....||||:::.||.||.:  .|.|....::.:    |.:::|:.:|..   :||.::.
 Worm    74 QDELISQTLKKFGRINILVNNAGASIPDAKKRTGIDQGI----ETYEQVMKLNVQ---SVIEMTQ 131

  Fly   128 GLMGANEPNQDGQRGVIVNTASVAAFD-GQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTIA 191
            .:    .|:....||.|||.:||.|.. |......|..:|||:...|...|..|.::|||:.|:.
 Worm   132 KV----RPHLAKSRGEIVNVSSVVALKAGWTRTPYYPLAKAALDQYTRSAAIALISEGIRVNTVN 192

  Fly   192 PGLFNT 197
            ||:..|
 Worm   193 PGIVQT 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 62/201 (31%)
F02C12.2NP_510229.1 FabG 4..263 CDD:223959 62/201 (31%)
NADB_Rossmann 5..267 CDD:304358 62/201 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1074094at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.