DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and dhs-30

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_510793.2 Gene:dhs-30 / 181761 WormBaseID:WBGene00000993 Length:311 Species:Caenorhabditis elegans


Alignment Length:208 Identity:51/208 - (24%)
Similarity:95/208 - (45%) Gaps:39/208 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGD-------KVVFVPVDV 59
            :||.|.::||.:||||::.|..|.|:||.|||....:.|..|:.:||.:       :.::...|:
 Worm    45 VKNKVVVITGASSGLGKSLAFELYKRGAQVILLARSTEKLKEICEELKETFPLNQNEPIYYYFDI 109

  Fly    60 TSEKDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAH--RLEDFQRVININTVGTFNV 122
            |..:....|      :..|:|:.:|.||.:        |:....  .:|..::.:..|   .|..
 Worm   110 TDSEQAPWA------EIPRVDILINNAGMS--------NRGSCQDTTMEIHRQAMETN---YFGH 157

  Fly   123 IRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIG---QAAYSASKAAVVGMTLPIARDLSTQG 184
            :.::..|:....|:     |.||.|:|:   .|::.   :.:|.|||.|:.|....:..:  .:.
 Worm   158 VHVTQALLSKLSPD-----GCIVVTSSI---QGKVAIPYRGSYGASKHALQGYFDCLRAE--HKN 212

  Fly   185 IRICTIAPGLFNT 197
            :.|..::.|..||
 Worm   213 LHILVVSAGYINT 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 51/207 (25%)
dhs-30NP_510793.2 NADB_Rossmann 45..291 CDD:304358 51/208 (25%)
PRK06181 47..290 CDD:235726 50/206 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.