DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and dhs-4

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_492563.1 Gene:dhs-4 / 172810 WormBaseID:WBGene00000968 Length:305 Species:Caenorhabditis elegans


Alignment Length:238 Identity:66/238 - (27%)
Similarity:106/238 - (44%) Gaps:33/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL----GDKVVFVPVDVTSEKDVSAA 68
            |:||..:|||:..|::.|.:||::||.|:.....:|:..|:    |:...: .|::.....::..
 Worm    44 LITGAGNGLGKLLAQKFAARGATLILWDINLQSVDELKNEIRGNQGEAHSY-EVNLCDPGKIAQV 107

  Fly    69 LQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLMGAN 133
            .|...:..|::|:.||.||.|||....:.::|..:|..|.....:..||..|    |.|.|...|
 Worm   108 GQQVINDIGKVDILVNNAGIATAKMILDSSENEINRSFDVNVKAHFYTVQQF----LPAMLKDNN 168

  Fly   134 EPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDL---STQGIRICTIAPGLF 195
                    |.||..||.|...|..|.|.||::|.|.||....:..::   ...|::...:.|...
 Worm   169 --------GHIVTIASAAGKMGSSGLADYSSTKHAAVGFHDSLVAEIMESEKNGVKTTLVCPYYV 225

  Fly   196 NTPMLAALPEKVRTFLAKSIP--FPQRLGEPSEYAHLVQAIYE 236
            :|.|..|      |..|...|  ||     ..:..::||.|:|
 Worm   226 HTSMFDA------TGAATRFPWIFP-----ILDTDYVVQKIFE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 66/238 (28%)
dhs-4NP_492563.1 adh_short 41..235 CDD:278532 58/209 (28%)
17beta-HSDXI-like_SDR_c 43..286 CDD:187598 66/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.