DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and DHRS7_ANOGA

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_315532.3 Gene:DHRS7_ANOGA / 1276215 VectorBaseID:AGAP005532 Length:317 Species:Anopheles gambiae


Alignment Length:270 Identity:59/270 - (21%)
Similarity:110/270 - (40%) Gaps:48/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGD--------KVVFVPVD 58
            :...|.|:||.:||||.|.|......|..|:||.....:...|.|:|.:        ..:.:|:|
Mosquito    46 LNGKVVLITGASSGLGEALAHSFFLAGCKVVLAARRKDELERVRKDLLELHATVPTHPPIILPLD 110

  Fly    59 VTSEKDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVI 123
            ::....:...:|:..:..|.:|:.||..|.:......:...:|.         |.|..|..|..:
Mosquito   111 LSDLNSIGGKVQSVLEIHGAIDILVNNGGISVRGDALSTAIDVD---------IRIMLVNYFGSV 166

  Fly   124 RLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRIC 188
            .|:...:.:....::|:   ||:.:||........::||||||.|:......:..:::...|::.
Mosquito   167 ALTKACLPSMMARKEGR---IVSISSVQGKFAIPHRSAYSASKHAMQAFCDSLRAEVAKDNIKVT 228

  Fly   189 TIAPGLFNTPM-LAAL-------------------PEKVRTFLAKSIPFPQR------LGEPSEY 227
            .|:||..||.: |.||                   |:...:.:.|:|...::      :...:.|
Mosquito   229 LISPGYINTALSLNALTGTGASYGKMDAATAGGASPQDTASSILKAIARDEKDVMLAPIAPRAAY 293

  Fly   228 --AHLVQAIY 235
              .||..::|
Mosquito   294 WLRHLAPSVY 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 59/269 (22%)
DHRS7_ANOGAXP_315532.3 11beta-HSD1_like_SDR_c 46..306 CDD:187593 59/270 (22%)
PRK06181 48..310 CDD:235726 59/268 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.