DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and AgaP_AGAP005499

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_315496.4 Gene:AgaP_AGAP005499 / 1276182 VectorBaseID:AGAP005499 Length:246 Species:Anopheles gambiae


Alignment Length:212 Identity:60/212 - (28%)
Similarity:98/212 - (46%) Gaps:28/212 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAK----ELGDKVVFVPVDVTSEKDVS 66
            |::|||.:||:|....:.||..|..||.....:.:..|:.|    |:..::.....|||||:.:.
Mosquito     8 VAIVTGASSGIGATAVKALATAGMVVIGLARRAERVLELKKTVPPEVAHRIHSHRCDVTSEQSIV 72

  Fly    67 AALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLMG 131
            .|......:||.:|:.:|.||.:....|.....|.|    |.:.|::.|.:|.         ::.
Mosquito    73 DAFALIDHQFGGVDVLINNAGVSKLTCTLLTAGNGA----DLRTVLDTNVMGL---------VLC 124

  Fly   132 ANEPNQDGQR----GVIVNTASVAA--FDGQIGQAAYSASKAAVVGMTLPIARDLSTQG--IRIC 188
            :.|..|..:|    |.|||..|:..  :.|......|.|||.||..:|..:..||..:|  :::.
Mosquito   125 SREAFQSMKRRSIDGHIVNINSILGHKYIGFPNLNIYGASKYAVTAITETLRNDLRNEGTRVKVT 189

  Fly   189 TIAPGLFNTPMLAALPE 205
            :|:||:..|.|   :||
Mosquito   190 SISPGIVRTEM---VPE 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 60/212 (28%)
AgaP_AGAP005499XP_315496.4 NADB_Rossmann 1..241 CDD:304358 60/212 (28%)
YdfG 6..246 CDD:226674 60/212 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.