DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and AgaP_AGAP011357

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_309293.4 Gene:AgaP_AGAP011357 / 1270582 VectorBaseID:AGAP011357 Length:292 Species:Anopheles gambiae


Alignment Length:232 Identity:59/232 - (25%)
Similarity:101/232 - (43%) Gaps:45/232 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVTGGASGLGRATAERLAKQGASVILA--DLPSSK--GNEVAKELGD-KVVFVPVDVTSEKDVSA 67
            ::||..||:|:.||..|||:||.||:|  ::.::|  ..|:..|.|: |::...||::|...|.|
Mosquito     8 IITGANSGIGKETARDLAKRGARVIMACRNMETAKQAQEEIMAETGNTKLLIKHVDISSLASVRA 72

  Fly    68 ALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLMGA 132
            ..:........:|:.::.||.|.     .||..|..  :..:..:..|..|.|.:..|...|:  
Mosquito    73 FAKEIVATEPVIDVLIHNAGVAQ-----GFNNKVTS--DGLEFTMATNYYGPFLLTHLLIDLL-- 128

  Fly   133 NEPNQDGQRGVIV----------NTASVAAFDGQIGQAA------YSASKAAVVGMTLPIARDLS 181
              ...|..|.|||          |.|::.:.: .|...:      |:.||.|.:..|..:||.|.
Mosquito   129 --KRSDQGRIVIVSSKLYQFASLNPANINSIN-PINYFSLFPIHLYNLSKFAEIMFTQELARRLR 190

  Fly   182 TQGIRICTIAPGLFNTPMLAALPEKVRTFLAKSIPFP 218
            ...:....:.||:.:|.            :.:::|||
Mosquito   191 GTKVTANCLHPGVIDTG------------IWRNVPFP 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 59/232 (25%)
AgaP_AGAP011357XP_309293.4 PRK06197 4..286 CDD:235737 59/232 (25%)
retinol-DH_like_SDR_c_like 4..276 CDD:212492 59/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.