DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and AgaP_AGAP012953

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_003436960.1 Gene:AgaP_AGAP012953 / 11175538 VectorBaseID:AGAP012953 Length:315 Species:Anopheles gambiae


Alignment Length:279 Identity:58/279 - (20%)
Similarity:107/279 - (38%) Gaps:56/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVA---KELGDKVVFVPVDVTSEK 63
            :...:.|:||...|:|:..:.:.|..|.:|:..|:......|..   |..|.|......|||:.:
Mosquito    52 VSGDIVLITGAGHGMGKNLSLQYAALGTTVVCVDVNEKTNQETVTAIKSKGGKAFGYTCDVTNRQ 116

  Fly    64 DVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIR-LSA 127
            .|....:..:::.|.:.:.:|.||...........:|      :.::..:||.:..|..|: |..
Mosquito   117 QVVDICKKIREQVGIVSILINNAGIMPTHPLLQQTEN------EIRKTFDINVLAHFWFIQSLLP 175

  Fly   128 GLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDL----STQGIRIC 188
            .::..|       ||.||..:|:|...|......|..:|.||.|:...::.:|    :...::..
Mosquito   176 DMIKQN-------RGHIVVLSSIAGMIGFKYLVPYCGTKFAVRGIMEALSEELRADPAKPNVKFT 233

  Fly   189 TIAPGLFNT----------PML-----------AALPEKVRTFLAKSIP------------FPQR 220
            ||.|.:.:|          |.|           |.:..:.|..:..|||            .|.|
Mosquito   234 TIYPYMVDTGLCKRPYTRFPSLLKMVKPDDAAAAIIDAQRRGLVEASIPKYLLYLNTWFRNMPLR 298

  Fly   221 LGEPSEYAHLVQAIYENPL 239
            :|:  |:..|:....::.|
Mosquito   299 VGQ--EFGDLLDTGLQSDL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 58/278 (21%)
AgaP_AGAP012953XP_003436960.1 17beta-HSDXI-like_SDR_c 56..299 CDD:187598 53/255 (21%)
adh_short 56..244 CDD:278532 45/200 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.