Sequence 1: | NP_523396.1 | Gene: | scu / 32789 | FlyBaseID: | FBgn0021765 | Length: | 255 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_878912.1 | Gene: | DHRS2 / 10202 | HGNCID: | 18349 | Length: | 300 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 53/204 - (25%) |
---|---|---|---|
Similarity: | 101/204 - (49%) | Gaps: | 23/204 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MIKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL------GDKVVFVPVDV 59
Fly 60 TSEKDVSAALQTAKDKFGRLDLTVNCAGTATAV-KTFNFNKNVAHRLEDFQRVININTVGTFNVI 123
Fly 124 RLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRIC 188
Fly 189 TIAPGLFNT 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
scu | NP_523396.1 | HSD10-like_SDR_c | 3..255 | CDD:187629 | 53/202 (26%) |
DHRS2 | NP_878912.1 | SDR | 27..>226 | CDD:330230 | 53/204 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |