DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and hsd17b3

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_012827001.1 Gene:hsd17b3 / 101730254 XenbaseID:XB-GENE-986068 Length:302 Species:Xenopus tropicalis


Alignment Length:225 Identity:53/225 - (23%)
Similarity:98/225 - (43%) Gaps:35/225 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL----GDKVVFVPVDVTSE---KD 64
            ::|||...|:|:|.:..||.:|.::::......|...||.::    |..|..:..|.|.:   :.
 Frog    47 AVVTGAGDGIGKAYSTELANRGMNIVMISRTLEKMQAVAMDIEQSTGKNVKIIQADFTKDNIYEH 111

  Fly    65 VSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRL---EDFQRVININTVGTFNVIRLS 126
            :...|:..|     :.:.:|..|..       .|.:....|   ::.:.|||.|...|..:.|:.
 Frog   112 IEEGLKGLK-----IGILINNVGML-------HNPDPCRFLSGPDNDKNVINCNITSTIKMTRII 164

  Fly   127 AGLMGANEPNQDGQRGVIVNTAS-VAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQGIRICTI 190
            ...|      :..:.|:|:|.:| |..|...: .|.||||||.|...:..:..:..::||.|..:
 Frog   165 LKQM------EKRKSGLILNISSAVGRFPCPL-YAVYSASKAFVTTFSKALQAEYKSKGIIIQAV 222

  Fly   191 APGLFNTPMLA-----ALPEKVRTFLAKSI 215
            .|...:|||..     |:.::...|:.:|:
 Frog   223 TPYGVSTPMTRNARTNAITKRPVDFVRQSL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 53/225 (24%)
hsd17b3XP_012827001.1 17beta-HSD1_like_SDR_c 44..281 CDD:187614 53/225 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.