DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scu and LOC100494804

DIOPT Version :9

Sequence 1:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_002934129.2 Gene:LOC100494804 / 100494804 -ID:- Length:512 Species:Xenopus tropicalis


Alignment Length:263 Identity:47/263 - (17%)
Similarity:83/263 - (31%) Gaps:93/263 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GASGLGRATAERLAKQGASVILADL--PSSKGNE---------VAKELGDKVVFVPVDVTS---E 62
            |...|....|:.:|.......|.||  ..:||:.         :..|..:|:.|.|.|||.   :
 Frog   234 GIKNLSSEQAKVIAGSDPDHALRDLLEAIAKGDYPSWTFSIQIMTFEQAEKMPFNPFDVTKVWYQ 298

  Fly    63 KDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSA 127
            |:....      ..|:|.|                |:|..:...|.:::       ......|..
 Frog   299 KEFPLI------PVGKLVL----------------NRNPTNYFADVEQI-------ALEPKNLVP 334

  Fly   128 GLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMT---LPIARDLSTQGIRICT 189
            |:    ||:.|            ....|::  .|||.:....:|:.   :|:.|   .||:::..
 Frog   335 GI----EPSPD------------RVLQGRL--FAYSDALRYRLGVNYTQIPVNR---PQGVKVAN 378

  Fly   190 -------IAPGLFNTPMLAALPEKVRTFLAKSIPFPQRLGEPSEYAHLVQAIYENPLLNGEVIRI 247
                   :.....|.|..                :|...|.|.:.|...:.::.   ::|:|.|.
 Frog   379 YERDGHMVIDNQGNAPSY----------------YPNSFGGPKDKAEYKEMVFH---VSGDVDRY 424

  Fly   248 DGA 250
            ..|
 Frog   425 HNA 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 47/263 (18%)
LOC100494804XP_002934129.2 KatE 20..491 CDD:223824 47/263 (18%)
catalase_clade_3 61..489 CDD:163712 47/263 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.