powered by:
Protein Alignment scu and synj2bp
DIOPT Version :9
Sequence 1: | NP_523396.1 |
Gene: | scu / 32789 |
FlyBaseID: | FBgn0021765 |
Length: | 255 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001106384.1 |
Gene: | synj2bp / 100127193 |
XenbaseID: | XB-GENE-954530 |
Length: | 145 |
Species: | Xenopus tropicalis |
Alignment Length: | 65 |
Identity: | 15/65 - (23%) |
Similarity: | 26/65 - (40%) |
Gaps: | 17/65 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 GRATAERLAKQGASVI------LADLPSSKGNEVAKELGDKVVFV-----------PVDVTSEKD 64
|.|.|:...::|..:: |.||..|...::.:..|:.||.. |:...||:|
Frog 49 GSAAADGRLQEGDQILEVNGVKLEDLLHSAAVDLFRNAGEHVVLKVRHKVQNQQNGPLSTRSERD 113
Fly 65 64
Frog 114 113
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.