powered by:
Protein Alignment scu and tmeff2
DIOPT Version :9
Sequence 1: | NP_523396.1 |
Gene: | scu / 32789 |
FlyBaseID: | FBgn0021765 |
Length: | 255 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_031748286.1 |
Gene: | tmeff2 / 100036670 |
XenbaseID: | XB-GENE-854443 |
Length: | 370 |
Species: | Xenopus tropicalis |
Alignment Length: | 57 |
Identity: | 16/57 - (28%) |
Similarity: | 23/57 - (40%) |
Gaps: | 12/57 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 GRLDLTVN-------C----AGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNV 122
||.:.||| | :|:....|.||....|...:. ||.|:....:||..:
Frog 272 GRCEHTVNMLKPWCRCDTGYSGSHCEKKDFNVLYVVPGPVR-FQYVLIAAVIGTIQI 327
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165174788 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.