DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7206 and SWT1

DIOPT Version :9

Sequence 1:NP_996499.1 Gene:CG7206 / 32788 FlyBaseID:FBgn0030892 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_014809.3 Gene:SWT1 / 854337 SGDID:S000005692 Length:458 Species:Saccharomyces cerevisiae


Alignment Length:325 Identity:80/325 - (24%)
Similarity:131/325 - (40%) Gaps:82/325 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 QKQLYEERNNNIVAK-INEEVIEKQPEAC-NITNPSAFDGSTASDME--VEPMEWQESIEEEAAQ 194
            :|:.:.:.||:|.:: .|..|..|..|:. :|.:.......|..|::  :......|:..:....
Yeast     4 EKRAFPKGNNHIRSETFNGSVSHKISESIKDIASLRPHGKYTVQDIDNIIASTSSHENRGQSGDS 68

  Fly   195 N---DQDEAKKGDDTLLMLPAES----IEEEAPQKGQDEA--------KEEDDTILMLQAADAEE 244
            |   :.||  :||..:..|..||    |.|....:.:.||        |..||..|:        
Yeast    69 NGCINHDE--EGDIPMCDLNDESDVEMISEYLSSQREMEAQSVANYMPKINDDLPLL-------- 123

  Fly   245 LPPRLEDYMYFVLDTNVLIHNHKFVERLTDVVLPGTVGSMLYLPYIVIKELDKLK---------- 299
            .||.|:  ..||:|||.:|.:...:|:|..  |..|...::.:|..||:|||.||          
Yeast   124 NPPTLK--TAFVVDTNFIISHLNTLEKLRS--LSSTYHHLIIVPTTVIQELDGLKKSPDIARDND 184

  Fly   300 --------------SKYQSDCLQRVIAMRAIRFLNTKFDESFQIQAQSALEEADHLIKIDCPDDS 350
                          :::.:|.:.:.:|......:..|..:|..   ..:|:           |||
Yeast   185 DTTNQEHDRTIGTLARWGNDWIYKNLANLDSGLIGQKLKQSLN---PGSLK-----------DDS 235

  Fly   351 ILNCCLQLQAQVP-HMILLTNDANLRLKANASNI-QVSCRSDL------MSTYVD---EFAGFGD 404
            ||:|||..:..:. .:|||:||.||..||...:| .||.|.::      |..|.:   .||...|
Yeast   236 ILDCCLYFKEILNCFVILLSNDKNLCTKALTEDILTVSFRKNMDAKIIAMRAYEENQLRFANLRD 300

  Fly   405  404
            Yeast   301  300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7206NP_996499.1 PIN_Smg5-Smg6-like 254..392 CDD:189050 44/169 (26%)
SWT1NP_014809.3 PIN_Swt1-like 133..280 CDD:350294 43/162 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346136
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007053
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1427
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.