DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7206 and swt1

DIOPT Version :9

Sequence 1:NP_996499.1 Gene:CG7206 / 32788 FlyBaseID:FBgn0030892 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_009293071.1 Gene:swt1 / 559432 ZFINID:ZDB-GENE-041015-373 Length:961 Species:Danio rerio


Alignment Length:376 Identity:91/376 - (24%)
Similarity:142/376 - (37%) Gaps:119/376 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 KEQGTTKRITHSSSASRRS--------SASTSTPQRLLKFPPKVAMNAWEKPKALVDANRLKAGR 117
            |.|..|.....:||.||..        .:|.:.||..|      .....:||:.:         .
Zfish   309 KAQTNTNLFNVNSSDSRTQITTQPSLPGSSPAKPQNFL------LRQQMQKPEEV---------S 358

  Fly   118 TQTAYQRLMLLRA-----SLQQKQLYEERNNNIV----AKINEEVIEKQPEACNITNPSAFDGST 173
            :||:|:...|..:     |.|.:.:|.:....:.    |..|::.|..|..      |..:|   
Zfish   359 SQTSYELSSLCSSHHSYVSRQVQLVYTDDKGEVTMTDGASHNDQHISSQKA------PKTYD--- 414

  Fly   174 ASDMEVEPMEWQESIEEEAAQNDQDEAKKGDDTLLMLPAESIEEEAPQKGQDEAKEEDDTILMLQ 238
             .|.||..:|.......|.......|...|:.|.:       :.:.|::|.       :|||..|
Zfish   415 -FDHEVHLVEELNLARSERRLEVNVEQNCGELTCM-------DIDPPEEGA-------NTILKKQ 464

  Fly   239 AADAEELPPRLEDYMYFVLDTNVLIHNHKFVERLTDVVLPGTVGSMLYLPYIVIKELDKLKS--- 300
            |             :..|||||||:.:.:||:::......|.....|.:|::|::|||.|||   
Zfish   465 A-------------LLIVLDTNVLLSHLEFVKKIRSRGFGGLGFPTLLIPWVVLQELDYLKSGKL 516

  Fly   301 ------------KYQSDCLQ----RVIAMRAIRFLNTKFDESFQIQAQSALEEADHLIKIDC--- 346
                        .|...||:    |:|.            :|.|:.:|:           ||   
Zfish   517 SSKVEDKARPAVHYIYSCLKNQEPRLIG------------QSMQLASQA-----------DCGPG 558

  Fly   347 ---PDDSILNCCLQLQAQVPH--MILLTNDANLRLKANASNIQVSCRSDLM 392
               .||.:|.||||.||..|.  ::|.|||.||..||..|.::...::||:
Zfish   559 VVNNDDRVLQCCLQYQALYPEGALVLCTNDKNLCSKALLSGVKAYSKADLV 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7206NP_996499.1 PIN_Smg5-Smg6-like 254..392 CDD:189050 49/164 (30%)
swt1XP_009293071.1 PIN_Smg5-Smg6-like 467..608 CDD:189050 48/163 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594881
Domainoid 1 1.000 61 1.000 Domainoid score I10482
eggNOG 1 0.900 - - E1_KOG4689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007053
OrthoInspector 1 1.000 - - oto40323
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1427
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.